jazzfest.wien

🖥 Status: up
🕒 Response Time: 0.238 sec
⬅️ Response Code: 200
jazzfest.wien

According to the accessibility report, jazzfest.wien has been checked 5 times in the last 635 days since November 18, 2024. Last recorded uptime on June 5, 2026, returning a code 200, jazzfest.wien was online 5 times from the complete assessments done. As of August 15, 2026, all evaluations conducted indicated that jazzfest.wien was not inaccessible. As of August 15, 2026, it has been reported that all received responses are free from errors. On June 5, 2026, jazzfest.wien responded in 0.238 seconds, its average being 0.471 seconds.

3.0
5
Last Updated: June 5, 2026

Jazzfest overview

Domain
jazzfest.wien
Title
JazzFest.Wien -
J Site Status Rank
696 371
Search Wikipedia
jazzfest.wien
Alternatives
alternatives to jazzfest.wien
Recently checked
nutrametrix.com

jomalatziba.blogfa.com

Last Updated: June 28, 2026
Status: up
Response Time: 0.262 sec
Response Code: 200

jbros.co.kr

Last Updated: July 7, 2026
Status: up
Response Time: 1.209 sec
Response Code: 200

chester-nj.org

Last Updated: July 12, 2026
Status: up
Response Time: 1.619 sec
Response Code: 200

jzqudou.com

Last Updated: May 13, 2026
Status: down
Response Time: — sec
Response Code:

hopeandsafetynj.org

Last Updated: June 22, 2026
Status: up
Response Time: 4.251 sec
Response Code: 200

jamesfox.ie

Last Updated: February 13, 2019
Status: up
Response Time: 0.626 sec
Response Code: 200

kiha5828notoji.blog.ocn.ne.jp

Last Updated: May 11, 2026
Status: down
Response Time: — sec
Response Code:

Jazzfest.wien
status check request map as of August 15, 2026

jazzfest.wien request, June 5, 2026

Country report for jazzfest.wien as of August 15, 2026

United States 100.00%
02:44
SiteTotal ChecksLast Modified
kasamterepyaarki.lifekasamterepyaarki.life11January 14, 2019
nutrametrix.comnutrametrix.com4January 29, 2025
jazzfest.wienjazzfest.wien5November 18, 2024
uncommondesignsonline.comuncommondesignsonline.com1July 7, 2026
dolphore-voyance.comdolphore-voyance.com1August 15, 2026

Jamesfox.ie

Jazzfest.wien

General SEO Report

Page TitlePage Title tips for jazzfest.wien: A well-optimized website title must strategically place your main target keywords close to the beginning to improve search engine rankings; it should be compelling enough to entice clicks while staying under the critical 60-character SEO limit and clearly indicating the page's subject matter to users.
JazzFest.Wien -

Length: 15 characters
Meta DescriptionMeta Description tips for jazzfest.wien: Don't forget to make each landing page unique by writing a specific meta description tailored to that page's content, rather than using a generic description across multiple pages.
no meta description data for jazzfest.wien
2026-08-15T01:14:13+00:00
Meta KeywordsMeta Keywords tips for jazzfest.wien: Don't invest resources in fine-tuning your meta keywords; instead, focus on building a strong topical authority by creating in-depth guides and resources that comprehensively cover your subject matter and naturally integrate your key search phrases.
no meta keywords data for jazzfest.wien
2026-08-15T01:14:13+00:00
Page ContentPage Content tips for jazzfest.wien: Develop concise comparison pages or guides that directly answer common questions like "What's the difference?" or "Which is better?" by structuring the page content to clearly contrast features and benefits side-by-side effectively.
Web Page Content Length: 12550 characters
H1 HeadingH1 Heading tips for jazzfest.wien: A well-optimized H1 header serves as the digital handshake of your webpage; it immediately informs both users and search engines about the relevance and primary purpose of your online content and offerings.
no h1 heading data for jazzfest.wien
2026-08-15T01:14:13+00:00
H2 HeadingsH2 Headings tips for jazzfest.wien: Effective use of H2 headers breaks down lengthy content into manageable sections, enhancing both readability for human visitors and aiding search engines in quickly grasping the page hierarchy and topic focus.
no h2 headings data for jazzfest.wien
2026-08-15T01:14:13+00:00
H3 HeadingsH3 Headings tips for jazzfest.wien: Strategically place H3 headers within your content structure to break down larger sections defined by H2 headings, improving both user readability and search engine comprehension of your webpage hierarchy.
no h3 headings data for jazzfest.wien
2026-08-15T01:14:13+00:00
H4 HeadingsH4 Headings tips for jazzfest.wien: Incorporating descriptive and keyword-rich H4 tags can subtly improve your site's relevance for longer-tail search queries related to your main content, capturing intent at deeper informational levels.
Jazz Fest Wien News

Count: 1 heading tag
H5-H6 HeadingsH5-H6 Headings tips for jazzfest.wien: avoid using H6 as an anchor link; rely on descriptive link text and potentially H3-H4 tags for main navigation anchors to maintain a clear semantic structure and improve click-through rates from search engine results pages (SERPs) effectively.
no h5-h6 headings data for jazzfest.wien
2026-08-15T01:14:13+00:00
Image ALT AttributesImage ALT Attributes tips for jazzfest.wien: Using descriptive and relevant image ALT text improves user experience for those with visual impairments while also signaling the page content to search engine bots.
https://www.jazzfest.wien/wp-content/themes/jazzfestwien/img/jfw_logo.png
https://www.jazzfest.wien/wp-content/themes/jazzfestwien/img/jfw_menu_icon.png


Count: 2 images with ALT attributes
Robots.txtRobots.txt tips for jazzfest.wien: Use robots.txt to strategically guide crawlers towards your preferred sitemap location (e.g., sitemap.xml) or specific URLs you wish to promote for indexing, although submitting sitemaps directly via Search Console is often more reliable than relying solely on the robots.txt file for sitemap discovery by crawlers.
file robots.txt was found on the website
XML SitemapXML Sitemap tips for jazzfest.wien: An XML sitemap serves as a vital navigation tool for search engine bots, providing explicit guidance on the hierarchy, priority, and frequency of updates for your website's important pages, thereby enhancing crawl efficiency and the likelihood of valuable content being indexed.
no xml sitemap data for jazzfest.wien
2026-08-15T01:14:13+00:00
Page SizePage Size tips for jazzfest.wien: For optimal performance and SEO, aim for consistently low HTML page size across all critical user journeys, especially homepage, category pages, and product pages.
page size: 12 kb
Response TimeResponse Time tips for jazzfest.wien: Employ efficient server-side rendering (SSR) or static site generation (SSG) methodologies to deliver fully rendered HTML rapidly, bypassing lengthy client-side JavaScript execution and improving initial response times.
response time: 0.471 sec
Minify CSSMinify CSS tips for jazzfest.wien: Accelerate your website's speed and responsiveness by minifying CSS, a process vital for achieving target Core Web Vitals scores, which search engines increasingly use as a ranking signal directly impacting organic visibility.
Minified:
https://www.jazzfest.wien/wp-includes/css/dist/block-library/style.min.css?ver=6.7.4
https://www.jazzfest.wien/wp-content/plugins/events-manager/includes/css/events-manager.min.css?ver=6.6.4.4
Unminified:
https://www.jazzfest.wien/wp-content/plugins/cookie-law-bar/static/css/cookie-law-bar.css?ver=6.7.4
https://www.jazzfest.wien/wp-content/themes/jazzfestwien/boilerplate.css?ver=20200131-001
https://www.jazzfest.wien/wp-content/themes/jazzfestwien/jfw.css?ver=20200131-001
https://www.jazzfest.wien/wp-content/themes/jazzfestwien/MyFontsWebfontsKit.css?ver=20200131-001
https://www.jazzfest.wien/wp-content/themes/jazzfestwien/jfw2.css?ver=20200131-001
https://www.jazzfest.wien/wp-content/themes/jazzfestwien/style.css?ver=20200131-001
https://www.jazzfest.wien/wp-content/plugins/newsletter/style.css?ver=8.7.6


included in the page
Minify JavaScriptMinify JavaScript tips for jazzfest.wien: Compress JavaScript assets through minification to lower the Largest Contentful Paint time, directly enhancing user-perceived page speed and responsiveness, which search engines now heavily weigh in ranking
Minified:
https://www.jazzfest.wien/wp-includes/js/jquery/jquery.min.js?ver=3.7.1
https://www.jazzfest.wien/wp-includes/js/jquery/jquery-migrate.min.js?ver=3.4.1
https://www.jazzfest.wien/wp-includes/js/jquery/ui/mouse.min.js?ver=1.13.3
https://www.jazzfest.wien/wp-includes/js/jquery/ui/sortable.min.js?ver=1.13.3
https://www.jazzfest.wien/wp-includes/js/jquery/ui/datepicker.min.js?ver=1.13.3
https://www.jazzfest.wien/wp-includes/js/jquery/ui/resizable.min.js?ver=1.13.3
https://www.jazzfest.wien/wp-includes/js/jquery/ui/draggable.min.js?ver=1.13.3
https://www.jazzfest.wien/wp-includes/js/jquery/ui/controlgroup.min.js?ver=1.13.3
https://www.jazzfest.wien/wp-includes/js/jquery/ui/checkboxradio.min.js?ver=1.13.3
https://www.jazzfest.wien/wp-includes/js/jquery/ui/button.min.js?ver=1.13.3
https://www.jazzfest.wien/wp-includes/js/jquery/ui/dialog.min.js?ver=1.13.3
https://www.jazzfest.wien/wp-content/themes/jazzfestwien/respond.min.js?ver=20200131-001
https://www.jazzfest.wien/wp-content/themes/jazzfestwien/js/jquery-finger/jquery.finger.min.js?ver=20200131-001
Unminified:
https://www.jazzfest.wien/wp-content/plugins/cookie-law-bar/static/js/cookie-law-bar.js?ver=6.7.4
https://www.jazzfest.wien/wp-includes/js/jquery/ui/core.min.js?ver=1.13.3
https://www.jazzfest.wien/wp-content/plugins/events-manager/includes/js/events-manager.js?ver=6.6.4.4
https://www.jazzfest.wien/wp-content/plugins/events-manager/includes/external/flatpickr/l10n/de.js?ver=6.6.4.4
https://www.jazzfest.wien/wp-content/themes/jazzfestwien/js/jazzfestwien_functions.js?ver=20200131-001


detected during site scan
Structured DataStructured Data tips for jazzfest.wien: Employ event schema markup for upcoming webinars, conferences, concerts, or workshops listed on your website by specifying essential elements like the event name, reliable start and end dates/times, accurate location (physical or virtual), ticket purchase information, and a compelling description, significantly improving visibility in local and national event search results and potentially driving ticket sales directly.
no structured data data for jazzfest.wien
2026-08-15T01:14:13+00:00
CDN UsageCDN Usage tips for jazzfest.wien: Avoid common CDN pitfalls such as improperly configuring cache control headers, neglecting to enable browser caching for the origin, or using the wrong CDN for dynamic content; correct configuration is essential for maximizing CDN benefits and ensuring optimal website performance globally.
no cdn usage data for jazzfest.wien
2026-08-15T01:14:13+00:00
SSL certificatesSSL certificates tips for jazzfest.wien: For websites that rely heavily on user logins, account creation, or collecting personal data, implementing SSL is not just a best practice but a critical requirement for GDPR, CCPA, and other data privacy regulations aimed at user data protection and security, directly influencing SEO and legal compliance.
SSL is enabled on the website

Estimated Traffic

Minimum Daily Unique Visitors:1 831
Minimum Daily Visits:2 140
Minimum Daily Page Views:3 684
Minimum Monthly Unique Visitors:54 930
Minimum Monthly Visits:64 200
Minimum Monthly Page Views:110 520
Minimum Yearly Unique Visitors:659 160
Minimum Yearly Visits:770 400
Minimum Yearly Page Views:1 326 240
Maximum Daily Unique Visitors:2 316
Maximum Daily Visits:2 471
Maximum Daily Page Views:4 169
Maximum Monthly Unique Visitors:69 480
Maximum Monthly Visits:74 130
Maximum Monthly Page Views:125 070
Maximum Yearly Unique Visitors:833 760
Maximum Yearly Visits:889 560
Maximum Yearly Page Views:1 500 840

Estimated Valuation

Daily Revenue:US$ 3 - 6
Monthly Revenue:US$ 90 - 180
Yearly Revenue:US$ 1 080 - 2 160

Estimated Worth

Minimum:US$ 1 620
Maximum:US$ 6 480

Similarly Ranked Sites

RankPoints
saxx-audio.desaxx-audio.de962 5649 451 617
ie-payments.comie-payments.com962 5659 451 617
absolute.co.thabsolute.co.th962 5669 451 616
kasamterepyaarki.lifekasamterepyaarki.life962 5679 451 615
nutrametrix.comnutrametrix.com962 5689 451 615
jazzfest.wienjazzfest.wien962 5699 451 614
uncommondesignsonline.comuncommondesignsonline.com962 5709 451 613
dolphore-voyance.comdolphore-voyance.com962 5719 451 612
darkxxxtube.comdarkxxxtube.com962 5729 451 612
konqueror.orgkonqueror.org962 5739 451 611
brucechingez.orgbrucechingez.org962 5749 451 610